Recombinant Human ADAMTS13 protein (ab112399)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVL YWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1328 to 1427
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • A disintegrin and metalloproteinase with thrombospondin motifs 13
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 13
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 13
    • ADAM metallopeptidase with thrombospondin type 1 motif 13
    • ADAM TS
    • ADAM-TS 13
    • ADAM-TS13
    • ADAMTS 13
    • ADAMTS-13
    • ADAMTS13
    • ADAMTS13 protein
    • ATS13_HUMAN
    • C9orf8
    • TTP
    • Von Willebrand factor cleaving protease
    • von Willebrand factor-cleaving protease
    • vWF cleaving protease
    • vWF CP
    • vWF-cleaving protease
    • vWF-CP
    • vWFCP
    see all
  • Function
    Cleaves the vWF multimers in plasma into smaller forms.
  • Tissue specificity
    Plasma. Expressed primarily in liver.
  • Involvement in disease
    Defects in ADAMTS13 are the cause of thrombotic thrombocytopenic purpura congenital (TTP) [MIM:274150]; also known as Upshaw-Schulman syndrome (USS). A hematologic disease characterized by hemolytic anemia with fragmentation of erythrocytes, thrombocytopenia, diffuse and non-focal neurologic findings, decreased renal function and fever.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 8 TSP type-1 domains.
  • Domain
    The pro-domain is not required for folding or secretion and does not perform the common function of maintening enzyme latency.
    The spacer domain is necessary to recognize and cleave vWF. The C-terminal TSP type-1 and CUB domains may modulate this interaction.
  • Post-translational
    modifications
    May contain a C-mannosylation site and O-fucosylation sites in the TSP type-1 domains.
    The precursor is processed by a furin endopeptidase which cleaves off the pro-domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human ADAMTS13 protein images

  • 12.5% SDS-PAGE analysis of ab112399. Stained with Coomassie Blue

References for Recombinant Human ADAMTS13 protein (ab112399)

ab112399 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up