Recombinant Human ADAMTS17 protein (ab153619)

Overview

  • Product name
    Recombinant Human ADAMTS17 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVC ENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGK ESPLLVAD
    • Amino acids
      543 to 650
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase with thrombospondin motifs 17
    • A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17
    • ADAM metallopeptidase with thrombospondin type 1 motif, 17
    • ADAM-TS 17
    • ADAM-TS17
    • ADAMTS 17
    • ADAMTS-17
    • ADAMTS17
    • ATS17_HUMAN
    • EC 3.4.24.
    • FLJ16363
    • FLJ32769
    • OTTHUMP00000194818
    see all
  • Tissue specificity
    Isoform 1 and isoform 2 are expressed at high levels in the lung, brain, whole eye and retina. Isoform 1 shows a weaker expression in the heart, kidney and skeletal muscle. Isoform 2 shows a weaker expression in the kidney, bone marrow and skeletal muscle. Isoform 1 and isoform 2 are expressed at high levels in the fetal heart, kidney, and whole eye, whereas a weak expression is seen in the fetal liver.
  • Involvement in disease
    Defects in ADAMTS17 are the cause of Weill-Marchesani-like syndrome (WMLS) [MIM:613195]. It is a disorder characterized by many of the key features of Weill-Marchesani syndrome, including lenticular myopia, ectopia lentis, glaucoma, spherophakia and short stature. However, the characteristic brachydactyly or decreased joint flexibility of Weill-Marchesani syndrome are absent.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 1 PLAC domain.
    Contains 5 TSP type-1 domains.
  • Domain
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab153619 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up