Recombinant Human ADAMTS3 protein (ab160521)

Overview

  • Product name
    Recombinant Human ADAMTS3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETP AKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
    • Amino acids
      1048 to 1128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 3
    • KIAA0366
    • PC II NP
    • Procollagen II amino propeptide processing enzyme
    • Procollagen II N proteinase
    • Zinc metalloendopeptidase
    see all
  • Relevance
    ADAMTS3 is a member of the larger family of ADAMs (A Disintegrin And Metalloproteinase) metalloproteinases containing thrombospondin (TS) repeats. ADAMTS3 (A Disintegrin And Metalloproteinase with ThromboSpondin 3 motif was first described in human brain. Human ADAMTS3 is 61% identical to human ADAMTS2. Both ADAMTS2 and ADAMTS3 have the ability to process procollagen II, but it is suggested that ADAMTS3 is the majorprocollagen II N-propeptidase. ADAMTS3 expression is found in placenta, cartilage, skin, lung, brain, and heart. Full length human ADAMTS3 contains 1201 amino acids and has a predicted mass of 135kDa, but glycosylation and the abundance of cysteine residues gives ADAMTS3 a greater apparent molecular weight on reduced SDS-PAGE gels. Purified ADAMTS3 resolves at a lower molecular weight of 108 kDa, due to cleavage at the furin site. ADAMTS3 contains the canonical HexxHxxxxxH zinc metalloproteinase motif, and has been shown to be proteolytically active, cleaving procollagen II. In addition to the metalloprotease domain, ADAMTS3 has a propeptide domain, a prohormone convertase (PC, furin) cleavage site, a cysteine-rich domain, and three thrombospondin-1 like domains, followed by a C-terminal domain unique to ADAMTS2 and ADAMTS3. ADAMTS3 does not have a transmembrane domain, unlike many of the ADAMs proteases, and is a secreted protein, much of which binds to the ECM (extracellular matrix).
  • Cellular localization
    Secreted. Associated with the extracellular matrix.

Images

  • ab160521 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up