Recombinant Human ADAMTS4 protein (ab152993)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEY TLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQ DTRLRYSFFV
    • Amino acids
      693 to 802
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A disintegrin and metalloproteinase with thrombospondin motifs 4
    • A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 4
    • A disintegrin like and metalloprotease with thrombospondin type 1 motif 4
    • ADAM metallopeptidase with thrombospondin type 1 motif 4
    • ADAM TS 4
    • ADAM TS4
    • ADAM-TS 4
    • ADAM-TS4
    • ADAMTS 2
    • ADAMTS 4
    • ADAMTS-4
    • ADAMTS2
    • ADAMTS4
    • ADAMTS4 protein
    • ADMP 1
    • ADMP-1
    • ADMP1
    • Aggrecanase 1
    • Aggrecanase-1
    • Aggrecanase1
    • ATS4_HUMAN
    • KIAA0688
    see all
  • Function
    Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-
    -Ala-393' site.
  • Tissue specificity
    Expressed in brain, lung and heart. Expressed at very low level in placenta and skeletal muscles.
  • Sequence similarities
    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 1 TSP type-1 domain.
  • Domain
    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab152993 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up