Recombinant Human ADAMTS6 protein (ab161336)

Overview

  • Product name
    Recombinant Human ADAMTS6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTI DWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRY
    • Amino acids
      725 to 824
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A Disintigrin And Metalloproteinase with ThromboSpondin motif 6
    • ADAMTS 6
    • Thrombospondin domain 2
  • Relevance
    ADAMTS6 was first described along with ADAMTS5 and ADAMTS7 in database searches for proteases containing the metalloprotease domain signature. A member of the metalloproteinase family containing disintegrin-like domains (ADAMs) the function of ADAMTS6 is still poorly understood, and as of this writing no substrates have been shown to be cleaved by ADAMTS6. ADAMTS6 contains the canonical HExxHxxxxxH zinc metalloproteinase motif, and is likely to be an active protease. In addition to the metalloprotease domain, ADAMTS6 has a propeptide domain, a Prohormone Convertase (PC, furin) cleavage site, a cysteine-rich domain, a spacer domain and five thrombospondin 1 like domains. The domain structure of ADAMTS6 is thus most like ADAMTS16 and ADAMTS19. ADAMTS6 does not have a transmembrane domain, unlike many of the ADAMs proteases, and is a secreted protein. Other ADAMTSs family members (ADAMTS4, ADAMTS5) have been more thoroughly studied, and are known to play key roles in aggrecan turnover. Analysis of breast cancer cell lines and RPE cells in the eye show elevated expression of ADAMTS6, and the original paper cited low levels of expression in the placenta. Three human sequences are currently reported, 1117, 860 and 468 amino acids in length respectively. The 860 amino acid sequence has a shorter spacer after the catalytic domain, and ends in the second thrombospondin domain. The 468 amino acid sequence ends at the start of the disintegrin domain. It remains to be seen where these different splice variants are expressed. The 1117 amino acid protein has a predicted mass of 125.27 kDa, the 860 form 97.11 kDa and the 468 form 53.12 kDa, but glycosylation and the abundance of cysteine residues gives ADAMTS6 a greater apparent molecular weight on reduced SDS PAGE gels. The furin consensus motif in ADAMTS6 means that the protein is likely to be cleaved when it is secreted.
  • Cellular localization
    Secreted protein; extracellular space; extracellular matrix.

Images

  • ab161336 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up