Overview

  • Product name
    Recombinant Human ADAT3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPV LDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPA SGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSF HEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVV DPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACS FAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVH ARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPD T
    • Amino acids
      1 to 351
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADAT3
    • ADAT3_HUMAN
    • adenosine deaminase, tRNA specific 3, TAD3 homolog (S. cerevisiae)
    • adenosine deaminase, tRNA-specific 3, TAD3 homolog
    • FWP005
    • LOC113179
    • MST121
    • MSTP121
    • Probable inactive tRNA-specific adenosine deaminase-like protein 3
    • S863 5
    • TAD3
    • TAD3, S. cerevisiae, homolog of
    • tRNA specific adenosine 34 deaminase subunit ADAT3
    • tRNA specific adenosine deaminase like protein 3
    • tRNA-specific adenosine deaminase 3 homolog
    • tRNA-specific adenosine-34 deaminase subunit ADAT3
    see all
  • Sequence similarities
    Belongs to the cytidine and deoxycytidylate deaminase family. ADAT3 subfamily.
  • Information by UniProt

Images

  • ab164996 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up