Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAHAAALGVQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARE RFEAVMAVLRELPRPMLLVLRNINTVRAINVALGAPVDRYFLMAKRAVRG WSRLAGATYRGVYGTSLLRHAKVVWEMLKFEVALRLETLAMRLTALLARA LVHLSLVPPAEELYQYLET
    • Amino acids
      1 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADCK 5
    • aarF domain containing protein kinase 5
    • ADCK5
    • ADCK5_HUMAN
    • Uncharacterized aarF domain containing protein kinase 5
    • Uncharacterized aarF domain-containing protein kinase 5
    see all
  • Function
    The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
  • Sequence similarities
    Belongs to the protein kinase superfamily. ADCK protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165897 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up