Overview

  • Product name
    Recombinant Human ADCY2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRM DSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMS RSLSQSNVAS
    • Amino acids
      977 to 1086
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3',5' cyclic AMP synthetase
    • Adenylate cyclase II
    • AC2
    • Adenylate cyclase 2
    • Adenylate cyclase 2 (brain)
    • Adenylate cyclase type 2
    • Adenylate cyclase type II
    • ATP pyrophosphate lyase 2
    • FLJ16822
    • FLJ45092
    • HBAC2
    • KIAA1060
    • MGC133314
    • Type II adenylate cyclase
    see all
  • Relevance
    ADCY2 is a membrane-bound, calmodulin-insensitive adenylyl cyclase.
  • Cellular localization
    Cell Membrane

Images

  • ab157849 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up