Overview

  • Product name
    Recombinant Human ADCY6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSV LLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDA
    • Amino acids
      701 to 800
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AC6
    • ACVI
    • ADCY 6
    • Adcy6
    • ADCY6_HUMAN
    • ADCYB
    • Adenylate cyclase 6
    • Adenylate cyclase type 6
    • Adenylate cyclase type VI
    • Adenylyl cyclase 6
    • ATP pyrophosphate lyase 6
    • ATP pyrophosphate-lyase 6
    • Ca(2+) inhibitable adenylyl cyclase
    • Ca(2+)-inhibitable adenylyl cyclase
    • DKFZp779F075
    • EC 4.6.1.1
    • KIAA0422
    see all
  • Function
    Membrane-bound, calcium-inhibitable adenylyl cyclase.
  • Sequence similarities
    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 2 guanylate cyclase domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab157851 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up