Recombinant Human Adducin 2 protein (ab116813)

Overview

  • Product nameRecombinant Human Adducin 2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35612
    • SpeciesHuman
    • SequenceMSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQ KKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHA VFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWA QLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSS CFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNA LLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVE EAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNAYLRVNVADEVQ RSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLEMRN KIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSE ETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVN GREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSK SPSKKKKKFRTPSFLKKSKKKEKVES
    • Molecular weight106 kDa including tags
    • Amino acids1 to 726

Specifications

Our Abpromise guarantee covers the use of ab116813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ADD 2
    • ADD2
    • ADDB
    • ADDB_HUMAN
    • Adducin 2 (beta)
    • Adducin2
    • Beta adducin
    • Beta-adducin
    • Erythrocyte adducin subunit beta
    • OTTHUMP00000203378
    • OTTHUMP00000203908
    see all
  • FunctionMembrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit.
  • Tissue specificityExpressed mainly in brain, spleen, kidney cortex and medulla, and heart. Also expressed in human umbilical vein endothelial cells, human vascular smooth muscle cells, kidney tubular cells and K562 cells.
  • Sequence similaritiesBelongs to the aldolase class II family. Adducin subfamily.
  • Developmental stageFetal kidney expresses isoforms 3, 4, 5, 6 and 7, and fetal liver expresses isoforms 3 and 4.
  • DomainEach subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt

Recombinant Human Adducin 2 protein images

  • 12.5% SDS-PAGE showing ab116813 at approximately 105.93kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Adducin 2 protein (ab116813)

ab116813 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"