Recombinant Human Adenosine A3 Receptor protein (ab114790)

Overview

  • Product name
    Recombinant Human Adenosine A3 Receptor protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVS VMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGA FYGRE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      121 to 225

Specifications

Our Abpromise guarantee covers the use of ab114790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A3AR
    • A3R
    • AA3R
    • AA3R_HUMAN
    • AD 026
    • AD026
    • Adenosine A3 receptor
    • Adenosine receptor A3
    • ADORA 3
    • ADORA3
    • ARA3
    • bA552M11.5
    • Gpcr2
    • RP11 552M11.7
    • TGPCR1
    see all
  • Function
    Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. Possible role in reproduction.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Phosphorylation on Ser-317 may be crucial for rapid desensitization.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114790 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up