Recombinant Human Adenosine A3 Receptor protein (ab114790)

Overview

  • Product nameRecombinant Human Adenosine A3 Receptor protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33765
    • SpeciesHuman
    • SequenceVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVS VMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGA FYGRE
    • Molecular weight37 kDa including tags
    • Amino acids121 to 225

Specifications

Our Abpromise guarantee covers the use of ab114790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A3AR
    • A3R
    • AA3R
    • AA3R_HUMAN
    • AD 026
    • AD026
    • Adenosine A3 receptor
    • Adenosine receptor A3
    • ADORA 3
    • ADORA3
    • ARA3
    • bA552M11.5
    • Gpcr2
    • RP11 552M11.7
    • TGPCR1
    see all
  • FunctionReceptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. Possible role in reproduction.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Phosphorylation on Ser-317 may be crucial for rapid desensitization.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Adenosine A3 Receptor protein images

  • ab114790 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Adenosine A3 Receptor protein (ab114790)

ab114790 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"