Recombinant human Adenylate Kinase 1 protein (ab167983)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEEKLKKTKIIFVVGGPGSGKGTQCEKIVQ KYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAM VAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLL KRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD SVFSQVCTHLDALK
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 194
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: > 6.0 units/ml. One unit will convert 2.0 µmoles of ADP to ATP + AMP per minute at pH 7.5 at 25C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Adenylate kinase 1
    • Adenylate kinase isoenzyme 1
    • Adenylate kinase soluble
    • AK 1
    • Ak1
    • ATP AMP transphosphorylase
    • ATP-AMP transphosphorylase 1
    • KAD1
    • KAD1_HUMAN
    • Myokinase
    see all
  • Function
    Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth.
  • Involvement in disease
    Defects in AK1 are the cause of hemolytic anemia due to adenylate kinase deficiency [MIM:612631].
  • Sequence similarities
    Belongs to the adenylate kinase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab167983 at 3 µg.

References

ab167983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up