Recombinant Human Adenylosuccinate Lyase protein (ab113582)

Overview

  • Product name
    Recombinant Human Adenylosuccinate Lyase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMAAGGDHGSPDSYR SPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQE MKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCY VGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQ LTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEG DDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHK ICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTL VMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVV YPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVV KQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEE VYPLLKPYESVMKVKAELCL
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 484
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab113582 is purified using conventional chromatography techniques: anion exchange chromatography followed by gel filtration chromatography with 20mM Tris pH 7.5, 2mM EDTA. No detergents such as urea, Triton or Tween etc. were used to purify the proteins.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Adenylosuccinase
    • Adenylosuccinate lyase
    • ADSL
    • AMPS
    • ASase
    • ASL
    • OTTHUMP00000199172
    • OTTHUMP00000199173
    • PUR8_HUMAN
    see all
  • Tissue specificity
    Ubiquitously expressed. Both isoforms are produced by all tissues. Isoform 2 is 10-fold less abundant than isoform 1.
  • Pathway
    Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 2/2.
    Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate: step 2/2.
  • Involvement in disease
    Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency) [MIM:103050]. ADSL deficiency is an autosomal recessive disorder characterized by the accumulation in the body fluids of succinylaminoimidazole-carboxamide riboside (SAICA-riboside) and succinyladenosine (S-Ado). Most children display marked psychomotor delay, often accompanied by epilepsy or autistic features, or both, although some patients may be less profoundly retarded. Occasionally, growth retardation and muscular wasting are also present.
  • Sequence similarities
    Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily.
  • Information by UniProt

Recombinant Human Adenylosuccinate Lyase protein images

  • 15% SDS-PAGE showing ab113582 at approximately 59kDa (3µg).

References for Recombinant Human Adenylosuccinate Lyase protein (ab113582)

ab113582 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up