Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSD EHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGK CRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQY TVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKP IQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI LPFEKINEGFDLLRSGKSIRTVLTF
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 375

Specifications

Our Abpromise guarantee covers the use of ab116935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADH gamma subunit
    • ADH1C
    • ADH1G_HUMAN
    • Adh3
    • Alcohol dehydrogenase 1C
    • Alcohol dehydrogenase 1C (class I) gamma polypeptide
    • Alcohol dehydrogenase 1C gamma polypeptide
    • Alcohol dehydrogenase 3
    • Alcohol dehydrogenase 3 (class I) gamma polypeptide
    • Alcohol dehydrogenase subunit gamma
    • Aldehyde reductase
    • Class I alcohol dehydrogenase
    • OTTHUMP00000220209
    see all
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116935 at approximately 67.32 kDa.

References

ab116935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up