Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVR IKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGD KVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVH HFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK VKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGAT ECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF
    • Amino acids
      1 to 386
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADH 4
    • ADH 7
    • ADH, class IV
    • ADH4
    • alcohol dehydrogenase 7
    • Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
    • alcohol dehydrogenase class 4 mu/sigma chain
    • Alcohol dehydrogenase class IV mu/sigma chain
    • alcohol dehydrogenase VII
    • class IV sigma 1 alcohol dehydrogenase
    • class IV sigmasigma alcohol dehydrogenase
    • Gastric alcohol dehydrogenase
    • Gastric H(+)/K(+) ATPase subunit alpha
    • Retinol dehydrogenase
    see all
  • Relevance
    This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members.
  • Cellular localization
    Cytoplasm

Images

  • ab157858 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up