Recombinant Human Adiponectin Receptor 1 protein (ab153328)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSF RACFKSIFRIHTETG
    • Amino acids
      72 to 136
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACDCR1
    • ADIPO R1
    • Adiponectin receptor protein 1
    • ADIPOR 1
    • Adipor1
    • ADR1_HUMAN
    • CGI 45
    • CGI 45 protein
    • CGI-45
    • CGI45
    • CGI45 protein
    • FLJ25385
    • FLJ42464
    • PAQR1
    • Progestin and adipoQ receptor family member I
    • TESBP1A
    see all
  • Function
    Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin.
  • Tissue specificity
    Widely expressed. Highly expressed in skeletal muscle. Expressed at intermediate level in brain, heart, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.
  • Sequence similarities
    Belongs to the ADIPOR family.
  • Domain
    The N-terminus is known to be cytoplasmic while the C-terminus is known to be extracellular.
  • Cellular localization
    Membrane. Localized to the cell membrane and intracellular organelles.
  • Information by UniProt

Images

  • ab153328 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up