Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGR WRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPG GASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDT LIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLP EAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFG VKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSK EDTVISL
    • Amino acids
      1 to 357
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Hydrolysation of ADP-ribosylagmatine and proteins ADP-ribosylated on arginine residues
  • Applications

    Functional Studies

  • Purity
    >= 98 % .
    ab157022 is affinity purified.
  • Form
    Liquid
  • Additional notes
    Hydrolysation of ADP-ribosylagmatine and proteins ADP-ribosylated on arginine residues
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.00
    Constituents: 1.04% Potassium chloride, 0.48% HEPES, 50% Glycerol, 0.03% Sodium chloride

General Info

  • Alternative names
    • [Protein ADP-ribosylarginine] hydrolase
    • ADP-ribose-L-arginine cleaving enzyme
    • ADP-ribosylarginine hydrolase
    • ADPRH
    • ADPRH_HUMAN
    • ARH1
    • EC 3.2.2.19
    see all
  • Function
    Catalyzes the reverse reaction of mono-ADP-ribosylation.
  • Sequence similarities
    Belongs to the ADP-ribosylglycohydrolase family.
  • Information by UniProt

References

ab157022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up