Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16186
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMTTSGALFPSLVPGSRGASNKYLVEF RAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIF PDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNE YLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAG LGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTR ATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNV PAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADE IQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEA FAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
    • Molecular weight45 kDa including tags
    • Amino acids1 to 407
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab124570 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • 110 kDa cell membrane glycoprotein
    • adhesion regulating molecule 1
    • Adhesion-regulating molecule 1
    • ADRM 1
    • Adrm1
    • ADRM1_HUMAN
    • ARM 1
    • ARM-1
    • ARM1
    • Gp110
    • hRpn13
    • M(r) 110,000 surface antigen
    • Proteasomal ubiquitin receptor ADRM1
    • proteasome regulatory particle non ATPase 13
    • Proteasome regulatory particle non-ATPase 13
    • Regulatory particle non ATPase 13
    • Rpn13
    • Rpn13 homolog
    see all
  • FunctionFunctions as a proteasomal ubiquitin receptor. Recruits the deubiquitinating enzyme UCHL5 at the 26S proteasome and promotes its activity.
  • Sequence similaritiesBelongs to the ADRM1 family.
    Contains 1 PH domain.
  • DomainThe PH domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human ADRM1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124570.

References for Recombinant Human ADRM1 protein (ab124570)

ab124570 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"