Overview

  • Product name
    Recombinant Human AE2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GEELLRSVAHFQRQMLKKREEQGRLLPTGAGLEPKSAQDKALLQMVEAAG AAEDDPLRRTGRPFGGLIRDVR
    • Molecular weight
      34 kDa including tags
    • Amino acids
      619 to 690

Specifications

Our Abpromise guarantee covers the use of ab114931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AE 2
    • AE2 anion exchanger
    • Anion exchange protein 2
    • Anion exchanger 2
    • B3A2_HUMAN
    • BAND 3-LIKE PROTEIN
    • BND3L
    • EPB3L1
    • erythrocyte band 3
    • Erythrocyte membrane protein band 3 like 1
    • HKB3
    • MPB3L
    • NBND3
    • Non-erythroid band 3-like protein
    • Slc4a2
    • Solute carrier family 4 member 2
    see all
  • Function
    Plasma membrane anion exchange protein of wide distribution.
  • Sequence similarities
    Belongs to the anion exchanger (TC 2.A.31) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human AE2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114931 at approximately 33.55kDa.

References for Recombinant Human AE2 protein (ab114931)

ab114931 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up