Overview

  • Product name
    Recombinant Human AE2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GEELLRSVAHFQRQMLKKREEQGRLLPTGAGLEPKSAQDKALLQMVEAAG AAEDDPLRRTGRPFGGLIRDVR
    • Molecular weight
      34 kDa including tags
    • Amino acids
      619 to 690

Specifications

Our Abpromise guarantee covers the use of ab114931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AE 2
    • AE2 anion exchanger
    • Anion exchange protein 2
    • Anion exchanger 2
    • B3A2_HUMAN
    • BAND 3-LIKE PROTEIN
    • BND3L
    • EPB3L1
    • erythrocyte band 3
    • Erythrocyte membrane protein band 3 like 1
    • HKB3
    • MPB3L
    • NBND3
    • Non-erythroid band 3-like protein
    • Slc4a2
    • Solute carrier family 4 member 2
    see all
  • Function
    Plasma membrane anion exchange protein of wide distribution.
  • Sequence similarities
    Belongs to the anion exchanger (TC 2.A.31) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab114931 at approximately 33.55kDa.

References

ab114931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up