Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFF LHNNRHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYV DMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRY LQYCRATNLYLDLRNIKRNHDRFKEDFFQSGEIGGHCKLDIRTLTSEGQR KSPLQSWFAELQSYTQLNFRPIEDAKCDIVIEKPTYFMKLDAGVNMYHHF CDFINLYITQHVNNSFSTDVYIVMWDTDGKIRVTILARSTEYRKILNQNE LVNALKTVSTFEVQIVDYKYRELGFLDQLRITHNTDIFIGMHGAGLTHLL FLPDWAAVFELYNCEDERCYLDLARLRGVHYITWRRQNKVFPQDKGHHPT LGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
    • Amino acids
      1 to 443
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AER61 glycosyltransferase
    • AOS4
    • C3orf64
    • EGF domain specific O linked N acetylglucosamine transferase
    • EGF domain-specific O-linked N-acetylglucosamine transferase
    • EGF O GlcNAc transferase
    • EGF-O-GlcNAc transferase
    • EOGT
    • EOGT_HUMAN
    • EOGT1
    • Extracellular O-linked N-acetylglucosamine transferase
    • Uncharacterized glycosyltransferase AER61
    see all
  • Relevance
    Function: Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains. Disease: Adams-Oliver syndrome 4 Similarity: Belongs to the glycosyltransferase 61 family.
  • Cellular localization
    Secreted

Images

  • ab166192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up