Overview

  • Product name
    Recombinant Human AF10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGML KSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH
    • Amino acids
      695 to 793
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF 10
    • AF10
    • AF10_HUMAN
    • ALL 1 fused gene from chromosome 10
    • ALL1 fused gene from chromosome 10
    • ALL1-fused gene from chromosome 10 protein
    • DKFZp686E10210
    • MGC75086
    • MLLT 10
    • MLLT10
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog Drosophila) translocated to 10
    • Myeloid/lymphoid or mixed lineage leukemia translocated to 10
    • OTTHUMP00000045273
    • Protein AF 10
    • Protein AF-10
    • Protein AF10
    • Type I AF10 protein
    see all
  • Function
    Probably involved in transcriptional regulation. In vitro or as fusion protein with KMT2A/MLL1 has transactivation activity. Binds to cruciform DNA.
  • Tissue specificity
    Expressed abundantly in testis.
  • Involvement in disease
    A chromosomal aberration involving MLLT10 is associated with acute leukemias. Translocation t(10;11)(p12;q23) with KMT2A/MLL1. The result is a rogue activator protein.
    A chromosomal aberration involving MLLT10 is associated with diffuse histiocytic lymphomas. Translocation t(10;11)(p13;q14) with PICALM.
  • Sequence similarities
    Contains 1 C2HC pre-PHD-type zinc finger.
    Contains 2 PHD-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159930 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up