Overview

  • Product name
    Recombinant Human AF4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPA SGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      71 to 170

Specifications

Our Abpromise guarantee covers the use of ab116759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AF 4
    • AF 4 protein
    • AF4
    • AF4-MLL
    • AF4/FMR2 family member 1
    • AFF 1
    • AFF1
    • AFF1_HUMAN
    • ALL1 fused gene from chromosome 4
    • ALL1-fused gene from chromosome 4 protein
    • FEL
    • MGC134969
    • MLL/AF4
    • MLLT2
    • myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila); translocated to, 2
    • MYELOID/LYMPHOID OR MIXED LINEAGE LEUKEMIA TRANSLOCATED TO 2; MLLT2
    • PBM1
    • Pre B cell monocytic leukemia partner 1
    • Protein AF-4
    • Protein FEL
    • Proto-oncogene AF4
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving AFF1 is associated with acute leukemias. Translocation t(4;11)(q21;q23) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similarities
    Belongs to the AF4 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human AF4 protein images

  • 12.5% SDS-PAGE analysis of ab116759 at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human AF4 protein (ab116759)

ab116759 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up