Overview

  • Product nameRecombinant Human AF4 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51825
    • SpeciesHuman
    • SequenceLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPA SGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
    • Molecular weight37 kDa including tags
    • Amino acids71 to 170

Specifications

Our Abpromise guarantee covers the use of ab116759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AF 4
    • AF 4 protein
    • AF4
    • AF4-MLL
    • AF4/FMR2 family member 1
    • AFF 1
    • AFF1
    • AFF1_HUMAN
    • ALL1 fused gene from chromosome 4
    • ALL1-fused gene from chromosome 4 protein
    • FEL
    • MGC134969
    • MLL/AF4
    • MLLT2
    • myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila); translocated to, 2
    • MYELOID/LYMPHOID OR MIXED LINEAGE LEUKEMIA TRANSLOCATED TO 2; MLLT2
    • PBM1
    • Pre B cell monocytic leukemia partner 1
    • Protein AF-4
    • Protein FEL
    • Proto-oncogene AF4
    see all
  • Involvement in diseaseNote=A chromosomal aberration involving AFF1 is associated with acute leukemias. Translocation t(4;11)(q21;q23) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similaritiesBelongs to the AF4 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human AF4 protein images

  • 12.5% SDS-PAGE analysis of ab116759 at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human AF4 protein (ab116759)

ab116759 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"