Overview

  • Product name
    Recombinant Human AF9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS SSSSSSSSSSSSSSSSSSSSSSGSSSSSSSSSSSSSSSSSTSFSKPHKLM KEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPK MAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKK SSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQ GPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDG SDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECD KAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSL DKTTVRKLQSYLETSGTS
    • Molecular weight
      88 kDa including tags
    • Amino acids
      1 to 568

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF 9
    • AF9_HUMAN
    • ALL1 fused gene from chromosome 9 protein
    • ALL1-fused gene from chromosome 9 protein
    • FLJ2035
    • MLLT3
    • Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein
    • Protein AF-9
    • YEATS 3
    • YEATS domain containing protein 3
    • YEATS domain-containing protein 3
    • YEATS3
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving MLLT3 is associated with acute leukemias. Translocation t(9;11)(p22;q23) with MLL/HRX. The result is a rogue activator protein.
  • Sequence similarities
    Contains 1 YEATS domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152532 stained with Coomassie Blue.

References

ab152532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up