Overview

  • Product name
    Recombinant Human AFF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPE WSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGE VEESNPSAKED
    • Molecular weight
      38 kDa including tags
    • Amino acids
      109 to 219

Specifications

Our Abpromise guarantee covers the use of ab116867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF4/FMR2 family member 2
    • AF4/FMR2 family, member 2
    • AFF2
    • AFF2_HUMAN
    • FMR2
    • FMR2P
    • Fragile X E mental retardation syndrome protein
    • fragile X mental retardation 2
    • Fragile X mental retardation 2 protein
    • fragile X mental retardation gene associated with FRAXE
    • FRAXE
    • mild or borderline mental retardation
    • MRX2
    • OTTHUMP00000024204
    • OX19
    • Protein FMR-2
    • Protein Ox19
    see all
  • Function
    RNA-binding protein. Might be involved in alternative splicing regulation through an interaction with G-quartet RNA structure.
  • Tissue specificity
    Brain (most abundant in hippocampus and amygdala), placenta and lung.
  • Involvement in disease
    Mental retardation, X-linked, associated with fragile site FRAXE
  • Sequence similarities
    Belongs to the AF4 family.
  • Cellular localization
    Nucleus speckle. When splicing is inhibited, accumulates in enlarged speckles.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116867 at approximately 37.84 kDa.

References

ab116867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up