Overview

  • Product name
    Recombinant Human AFF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPE WSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGE VEESNPSAKED
    • Molecular weight
      38 kDa including tags
    • Amino acids
      109 to 219

Specifications

Our Abpromise guarantee covers the use of ab116867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF4/FMR2 family member 2
    • AF4/FMR2 family, member 2
    • AFF2
    • AFF2_HUMAN
    • FMR2
    • FMR2P
    • Fragile X E mental retardation syndrome protein
    • fragile X mental retardation 2
    • Fragile X mental retardation 2 protein
    • fragile X mental retardation gene associated with FRAXE
    • FRAXE
    • mild or borderline mental retardation
    • MRX2
    • OTTHUMP00000024204
    • OX19
    • Protein FMR-2
    • Protein Ox19
    see all
  • Function
    RNA-binding protein. Might be involved in alternative splicing regulation through an interaction with G-quartet RNA structure.
  • Tissue specificity
    Brain (most abundant in hippocampus and amygdala), placenta and lung.
  • Involvement in disease
    Mental retardation, X-linked, associated with fragile site FRAXE
  • Sequence similarities
    Belongs to the AF4 family.
  • Cellular localization
    Nucleus speckle. When splicing is inhibited, accumulates in enlarged speckles.
  • Information by UniProt

Recombinant Human AFF2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116867 at approximately 37.84 kDa.

References for Recombinant Human AFF2 protein (ab116867)

ab116867 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up