Overview

  • Product nameRecombinant Human AFM protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43652
    • SpeciesHuman
    • SequenceMKLLKLTGFIFFLFFLTESLTLPTQPRDIENFNSTQKFIEDNIEYITIIA FAQYVQEATF EEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKI CAMEGLPQKHNFSHCCSKVDAQ RRLCFFYNKKSDVGFLPPFPTLDPEE KCQAYESNRESLLNHFLYEVARRNPFVFAPTLLT VAVHFEEVAKSCCE EQNKVNCLQTRAIPVTQYLKAFSSYQKHVCGALLKFGTKVVHFIYI AI LSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRDTSKVMNHICSKQ DSISSKIK ECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVC QERDADPDTFFAKFTFEYSR RHPDLSIPELLRIVQIYKDLLRNCCNTE NPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ NLGKDGLKYHYLIRLT KIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFG ELCG VNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHAD MCQSQN EELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCK AESPEVCFNEESPKIGN
    • Molecular weight96 kDa including tags
    • Amino acids1 to 599

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AFAM_HUMAN
    • Afamin
    • Afm
    • ALB 2
    • ALB2
    • ALBA
    • ALF
    • Alpha albumin
    • Alpha-Alb
    • Alpha-albumin
    see all
  • FunctionVitamin E binding protein. May transport vitamin E in body fluids under conditions where the lipoprotein system is not sufficient or across the blood-brain barrier.
  • Sequence similaritiesBelongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human AFM protein images

  • 12.5% SDS-PAGE showing ab114886 at approximately 96.10kDa.
    Stained with Coomassie Blue.

References for Recombinant Human AFM protein (ab114886)

ab114886 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"