Overview

  • Product name
    Recombinant Human AGFG1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCT SCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDR SSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASS TSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLL SDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSS GSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFN TSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFG TTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNA SSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNP FQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAA FPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQ FPTGSSSTNPFL
    • Amino acids
      1 to 562
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGFG1
    • AGFG1_HUMAN
    • Arf-GAP domain and FG repeats-containing protein 1
    • ArfGAP with FG repeats 1
    • AU045498
    • C130049H11Rik
    • C85612
    • D730048C23Rik
    • DKFZp686I15205
    • HIV 1 Rev binding protein
    • HIV-1 Rev-binding protein
    • HRB
    • MGC116375
    • MGC116938
    • MGC116940
    • Nucleoporin like protein RIP
    • Nucleoporin-like protein RIP
    • RAB
    • Rev interacting protein
    • Rev-interacting protein
    • Rev/Rex activation domain-binding protein
    • RIP
    see all
  • Function
    Required for vesicle docking or fusion during acrosome biogenesis (By similarity). May play a role in RNA trafficking or localization. In case of infection by HIV-1, acts as a cofactor for viral Rev and promotes movement of Rev-responsive element-containing RNAs from the nuclear periphery to the cytoplasm. This step is essential for HIV-1 replication.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 1 Arf-GAP domain.
  • Domain
    Contains FG repeats. The FG repeat region is required for acting as a cofactor of HIV-1 Rev.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Nucleus. Cytoplasmic vesicle.
  • Information by UniProt

Images

  • ab158696 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up