Recombinant Human Aggrecan protein (ab114254)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIP CYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAY QDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVV KGIVFHYRAISTRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCD AGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNETYDVYCFAEE MEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYT GEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILT VKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPGL GPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQAC LRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKD SSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGV RTVYLYPNQTGLPDPLSRHHAFCFRGMQPHFGSNSPFCLERTPLGSPDPA TTQYPIHQSKKMSVPLGQSQL
    • Molecular weight105 kDa including tags
    • Amino acids1 to 721

Specifications

Our Abpromise guarantee covers the use of ab114254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAN
    • AGC 1
    • AGC1
    • AGCAN
    • Aggrecan 1
    • Aggrecan 1 (chondroitin sulfate proteoglycan 1, large aggregating proteoglycan, antigen identified by monoclonal antibody A0122)
    • Aggrecan core protein
    • Aggrecan proteoglycan
    • Aggrecan structural proteoglycan of cartilage
    • Aggrecan1
    • ATEGQV
    • Cartilage specific proteoglycan core protein
    • Chondroitin sulfate proteoglycan 1
    • Chondroitin sulfate proteoglycan 1 large aggregating proteoglycan antigen identified by monoclonal antibody A0122
    • Chondroitin sulfate proteoglycan core protein 1
    • CSPG 1
    • CSPG1
    • CSPGCP
    • JSCATE
    • Large aggregating proteoglycan
    • mcspg
    • mgsk16
    • MSK 16
    • MSK16
    • SEDK
    see all
  • RelevanceAggrecan is a member of a family of large, aggregating proteoglycans (also including versican, brevican and neurocan) which is found in articular cartilage. Aggrecan is composed of three major domains: G1, G2, and G3. Between the G1 and G2 domains there is an interglobulin region (IGD). The IGD region is the major site of cleavage by specific proteases like metalloproteinases (MMPs) and aggrecanase. Aggrecan cleavage has been associated with a number of degenerative diseases including rheumatoid arthritis and osteoarthritis. There is evidence that this family of proteoglycans modulates cell adhesion, migration, and axonal outgrowth in the CNS.
  • Cellular localizationSecreted; extracellular matrix.

Recombinant Human Aggrecan protein images

  • ab114254 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Aggrecan protein (ab114254)

ab114254 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"