Recombinant Human AGPAT7 protein (ab166035)

Overview

  • Product name
    Recombinant Human AGPAT7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIR VLLAFIVLFLLWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLL FFLLGFLRIRVRGQRASRLQAPVLVAAPHSTFFDPIVLLPCDLPKVVSRA ENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLF FPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWRGPGVL KVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPG RSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALD GGRSLEELTRLAFELFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPAATA LHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTP NASSPGNPTALANGTVQAPKQKGD
    • Amino acids
      1 to 524
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 acyl sn glycerol 3 phosphate acyltransferase eta
    • 1 AGP acyltransferase 7
    • 1 AGPAT 7
    • Acyltransferase like 3
    • AGPAT7
    • AYTL3
    • LPAAT eta
    • Lpcat4
    • LPEAT2
    • Lysophosphatidic acid acyltransferase eta
    • Lysophosphatidylcholine acyltransferase 4
    see all
  • Relevance
    Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are involved in signal transduction (Ye et al., 2005 [PubMed 16243729]).[supplied by OMIM]
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein

Images

  • ab166035 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up