Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQT YEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIM LNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRD LPLLIENMKKALRLIQSEL
    • Molecular weight
      20 kDa including tags
    • Amino acids
      22 to 166
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab108127 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AG-3
    • AG3
    • Agr3
    • AGR3_HUMAN
    • Anterior gradient 3, xenopus, homolog of
    • Anterior gradient homolog 3
    • Anterior gradient homolog 3 (Xenopus laevis)
    • anterior gradient protein 3
    • Anterior gradient protein 3 homolog
    • BCMP11
    • Breast cancer membrane protein 11
    • Gm888
    • hAG 3
    • hAG-3
    • HAG3
    • OTTHUMP00000158512
    • PDIA18
    • Protein disulfide isomerase family A member 18
    see all
  • Sequence similarities
    Belongs to the AGR family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108127.

References

ab108127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up