Overview

  • Product name
    Recombinant Human AGXT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDH FDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      293 to 392

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AGT
    • AGT1
    • Agxt
    • AGXT1
    • Alanine glyoxylate aminotransferase
    • Alanine glyoxylate aminotransferase3
    • Alanine--glyoxylate aminotransferase
    • EC 2.6.1.44
    • EC 2.6.1.51
    • Hepatic peroxisomal alanine glyoxylate aminotransferase
    • Hepatic peroxisomal alanine:glyoxylate aminotransferase
    • L alanine glyoxylate aminotransferase 1
    • MS773
    • PH1
    • Serine pyruvate aminotransferase
    • Serine--pyruvate aminotransferase
    • Serine--pyruvate aminotransferase, mitochondrial
    • Serine:pyruvate aminotransferase
    • SPAT
    • SPT
    • SPYA_HUMAN
    • TLH6
    see all
  • Tissue specificity
    Liver.
  • Involvement in disease
    Defects in AGXT are the cause of hyperoxaluria primary type 1 (HP1) [MIM:259900]; also known as primary hyperoxaluria type I (PH1) and oxalosis I. HP1 is a rare autosomal recessive inborn error of glyoxylate metabolism characterized by increased excretion of oxalate and glycolate, and the progressive accumulation of insoluble calcium oxalate in the kidney and urinary tract.
  • Sequence similarities
    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Peroxisome. Mitochondrion matrix. Except in some HP1 patients where AGT is found in the mitochondrial matrix.
  • Information by UniProt

Recombinant Human AGXT protein images

  • 12.5% SDS-PAGE showing ab117019 at approximately 36.63 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human AGXT protein (ab117019)

ab117019 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up