Recombinant Human AHNAK2 protein (ab164994)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLPETQVLPGEIDETPLSKPGHDLASMEDKTEKWSSQPEGPLKLKASST DMPSQISVVNVDQLWEDSVLTVKFPKLMVPRFSFAAPSSEDDVFIPTVRE VQCPEANIDTALCKESPGLWGASILKAGAGVPGEQPVDLNLPLEAPPISK VRVHIQGAQVESQEVTIHSIVTPEFVDLSVPRTFSTQIVRESEIPTSEIQ TPSYGFSLLKVKIPEPHTQARVYTTMTQHSRTQEGTEEAPIQATPGVDSI SGDLQPDTGEPFEMISSSVNVLGQQTLTFEVPSGHQLADSCSDEEPAEIL EFPPDDSQEATTPLADEGRAPKDKPESKKSGLLWFWLPNIGFSSSVDETG VDSKNDVQRSAPIQTQPEARPEAELPKKQEKAGWFRFPKLGFSSSPTKKS KSTEDGAELEEQKLQEETITFFDARESFSPEEKEEGELIGPVGTGLDSRV MVTSAARTELILPEQDRKADDESKGSGLGPNEG
    • Amino acids
      1 to 483
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AHNAK 2
    • AHNAK nucleoprotein 2
    • C14orf78
    • chromosome 14 open reading frame 78
    • KIAA2019
    see all
  • Relevance
    AHNAK2 contains 1 PDZ (DHR) domain. There are 3 named isoforms of AHNAK2 produced by alternative splicing. AHNAK2 is a 600-kDa protein composed of a large number of highly conserved repeat segments. AHNAKs are a class of giant propeller-like proteins that associate with calcium channel proteins of cardiomyocytes and other cells.
  • Cellular localization
    Nuclear

Images

  • ab164994 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up