Overview

  • Product name
    Recombinant Human AHRR protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRA AEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
    • Amino acids
      617 to 715
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AHH
    • AhR repressor
    • AhRR
    • AHRR_HUMAN
    • aryl hydrocarbon hydroxylase regulator
    • aryl hydrocarbon receptor regulator
    • Aryl hydrocarbon receptor repressor
    • Arylhydrocarbon receptor repressor
    • bHLHe77
    • Class E basic helix-loop-helix protein 77
    • Dioxin receptor repressor
    • KIAA1234
    • MGC167813
    • MGC176630
    • OTTHUMP00000221488
    • OTTHUMP00000221489
    see all
  • Function
    Mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Represses the transcription activity of AHR by competing with this transcription factor for heterodimer formation with the ARNT and subsequently binding to the xenobiotic response element (XRE) sequence present in the promoter regulatory region of variety of genes. Represses CYP1A1 by binding the XRE sequence and recruiting ANKRA2, HDAC4 and/or HDAC5. Autoregulates its expression by associating with its own XRE site.
  • Tissue specificity
    Highly expressed in testis, lung, ovary, spleen and pancreas. Highly expressed in mononuclear cells (MNCs) from umbilical cord blood. Isoform 3 is highly expressed in lung, kidney, spleen and thymus. Down-regulated malignant tissue from different anatomical origins, including colon, breast, lung, stomach, cervix, and ovary.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly in the nuclear compartment. First cytoplasmic, translocates into the nuclear compartment upon interaction with ARNT in the cytoplasmic compartment.
  • Information by UniProt

Images

  • ab153451 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up