Overview

  • Product nameRecombinant Human AIF1L protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BQI0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSGELSNRFQGGKAFGLLKARQERRLAEIN REFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLG VPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKA NESSPKPVGPPPERDIASLP
    • Molecular weight19 kDa including tags
    • Amino acids1 to 150
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103302 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AI043124
    • AIF 1L
    • AIF1L
    • AIF1L_HUMAN
    • Allograft inflammatory factor 1 like
    • Allograft inflammatory factor 1-like
    • C87647
    • C9orf58
    • FLJ12783
    • IBA2
    • Ionized calcium binding adapter molecule 2
    • Ionized calcium-binding adapter molecule 2
    • MGC29466
    see all
  • FunctionActin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function.
  • Sequence similaritiesContains 2 EF-hand domains.
  • Cellular localizationCytoplasm > cytoskeleton. Cell projection > ruffle membrane. Colocalizes with F-actin. Partially relocates to membrane ruffles in response to invading bacteria.
  • Information by UniProt

Recombinant Human AIF1L protein images

  • 15% SDS-PAGE analysis of 3µg ab103302.

References for Recombinant Human AIF1L protein (ab103302)

ab103302 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"