Overview

  • Product name
    Recombinant Human AIF1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSGELSNRFQGGKAFGLLKARQERRLAEIN REFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLG VPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKA NESSPKPVGPPPERDIASLP
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 150
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103302 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AI043124
    • AIF 1L
    • AIF1L
    • AIF1L_HUMAN
    • Allograft inflammatory factor 1 like
    • Allograft inflammatory factor 1-like
    • C87647
    • C9orf58
    • FLJ12783
    • IBA2
    • Ionized calcium binding adapter molecule 2
    • Ionized calcium-binding adapter molecule 2
    • MGC29466
    see all
  • Function
    Actin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function.
  • Sequence similarities
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > ruffle membrane. Colocalizes with F-actin. Partially relocates to membrane ruffles in response to invading bacteria.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103302.

References

ab103302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up