Overview

  • Product name
    Recombinant Human AIFM3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFH TEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNG EFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDS LHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIV GAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLA LRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSS PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAY LTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSEL RGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIP VNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNM LAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYT KGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS
    • Amino acids
      1 to 598
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AIFL
    • Aifm3
    • AIFM3_HUMAN
    • Apoptosis inducing factor 3
    • Apoptosis inducing factor like
    • Apoptosis inducing factor like protein
    • Apoptosis inducing factor, mitochondrion associated
    • Apoptosis-inducing factor 3
    • Apoptosis-inducing factor-like protein
    • FLJ30473
    • FLJ45137
    see all
  • Function
    Induces apoptosis through a caspase dependent pathway. Reduces mitochondrial membrane potential.
  • Tissue specificity
    Ubiquitous. Expressed in bone marrow, cerebral cortex, liver, ovary, thymus, thyroid gland and tongue (at protein level).
  • Sequence similarities
    Belongs to the FAD-dependent oxidoreductase family.
    Contains 1 Rieske domain.
  • Domain
    The Rieske domain induces apoptosis.
  • Cellular localization
    Mitochondrion. Does not translocate to the nucleus upon induction of apoptosis.
  • Information by UniProt

Images

  • ab165603 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up