Overview

  • Product name
    Recombinant Human AIG1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALVPCQALRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQ AVFFGICVLTDLSSLLTRGSGNQERERQLKKLISLRDWMLAVLAFPVGVF VVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHH QHPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFF GSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2LD1
    • AIG 1
    • AIG-1
    • AIG1
    • AIG1_HUMAN
    • Androgen induced 1
    • Androgen induced protein (AIG-1)
    • Androgen induced protein (AIG-1), C-terminus truncated
    • Androgen-induced gene 1 protein
    • dJ95L4.1
    • DKFZp686F03136
    • FLJ10485
    • GGACT
    • RP1 95L4.1
    see all
  • Function
    May play a role in androgen-regulated growth of hair follicles.
  • Tissue specificity
    Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AIG1 expression is higher in hair follicles from males than from females.
  • Sequence similarities
    Belongs to the AIG1 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162540 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up