Recombinant Human AIMP2/p38 protein (ab152832)

Overview

  • Product name
    Recombinant Human AIMP2/p38 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNL SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT LTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLS TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS IQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSK EKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQ RWMRSCENLAPFNTALKLLK
    • Molecular weight
      62 kDa including tags
    • Amino acids
      1 to 320

Specifications

Our Abpromise guarantee covers the use of ab152832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aimp2
    • AIMP2_HUMAN
    • Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
    • Aminoacyl tRNA synthetase complex interacting multifunctional protein 2
    • ARS interacting multi functional protein 2
    • JTV 1
    • JTV 1 protein
    • JTV1
    • JTV1 gene
    • Multisynthase complex auxiliary component p38
    • Multisynthetase complex auxiliary component p38
    • P38
    • PRO0992
    • Protein JTV 1
    • Protein JTV-1
    • tRNA SYNTHETASE COFACTOR p38
    see all
  • Function
    Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
  • Sequence similarities
    Contains 1 GST C-terminal domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues in response to UV irradiation.
    Ubiquitinated by PARK2, leading to its degradation by the proteasome. Mutant PARK2 fails to ubiquitinate AIMP2 efficiently, allowing its accumulation which may contribute to neurodegeneration associated with Parkinson disease.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. Following DNA damage, dissociates from the aminoacyl-tRNA synthase complex and translocates from the cytoplasm to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152832 stained with Coomassie Blue.

References

ab152832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up