Recombinant Human AIMP3/p18 protein (ab106904)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGNKYSAQGERQI PVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVT QVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVD LTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 174
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106904 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • AIMP 3
    • AIMP3
    • Aminoacyl tRNA synthetase complex interacting multifunctional protein 3
    • Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
    • ARS interacting multifunctional protein 3
    • EEF1E1
    • Elongation factor p18
    • Eukaryotic translation elongation factor 1 epsilon 1
    • Eukaryotic translation elongation factor 1 epsilon-1
    • Homolog of rat elongation factor p18
    • MCA3_HUMAN
    • Multisynthase complex auxiliary component p18
    • Multisynthetase complex auxiliary component p18
    • p18
    • p18 component of aminoacyl tRNA synthetase complex
    see all
  • Function
    Positive modulator of ATM response to DNA damage.
  • Tissue specificity
    Down-regulated in various cancer tissues.
  • Sequence similarities
    Contains 1 GST C-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
  • Information by UniProt

Recombinant Human AIMP3/p18 protein images

  • 15% SDS-PAGE showing ab106904 at approximately 21.9kDa (3µg).

References for Recombinant Human AIMP3/p18 protein (ab106904)

ab106904 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up