Recombinant Human AIMP3/p18 protein (His tag) (ab185591)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAH LVKQANKEYLL GSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL NSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCH IQHYPGIRQHLSSVVFIKNRLYTNSH
    • Molecular weight
      19 kDa
    • Amino acids
      1 to 174
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    Purification of ab185591 was by multi-step chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 78% PBS, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • AIMP 3
    • AIMP3
    • Aminoacyl tRNA synthetase complex interacting multifunctional protein 3
    • Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
    • ARS interacting multifunctional protein 3
    • EEF1E1
    • Elongation factor p18
    • Eukaryotic translation elongation factor 1 epsilon 1
    • Eukaryotic translation elongation factor 1 epsilon-1
    • Homolog of rat elongation factor p18
    • MCA3_HUMAN
    • Multisynthase complex auxiliary component p18
    • Multisynthetase complex auxiliary component p18
    • p18
    • p18 component of aminoacyl tRNA synthetase complex
    see all
  • Function
    Positive modulator of ATM response to DNA damage.
  • Tissue specificity
    Down-regulated in various cancer tissues.
  • Sequence similarities
    Contains 1 GST C-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
  • Information by UniProt

Images

  • SDS Page analysis of 3.5 μg ab185591.

References

ab185591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up