Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHS LHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFT IADSPTGQRV
    • Amino acids
      519 to 628
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activin receptor interacting protein 1
    • Acvri1
    • Acvrinp1
    • ACVRIP1
    • AIP 1
    • Aip-1
    • ARIP1
    • Atrophin 1 interacting protein 1
    • Atrophin 1 interacting protein A
    • Atrophin-1-interacting protein 1
    • Atrophin-1-interacting protein A
    • KIAA0705
    • MAGI-2
    • MAGI2
    • MAGI2_HUMAN
    • Membrane associated guanylate kinase 2
    • Membrane associated guanylate kinase inverted 2
    • Membrane associated guanylate kinase WW and PDZ domain containing 2
    • Membrane associated guanylate kinase WW and PDZ domain containing protein 2
    • Membrane-associated guanylate kinase
    • Membrane-associated guanylate kinase inverted 2
    • S SCAM
    • SSCAM
    • WW and PDZ domain-containing protein 2
    see all
  • Function
    Seems to act as scaffold molecule at synaptic junctions by assembling neurotransmitter receptors and cell adhesion proteins. May play a role in regulating activin-mediated signaling in neuronal cells. Enhances the ability of PTEN to suppress AKT1 activation.
  • Tissue specificity
    Specifically expressed in brain.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 6 PDZ (DHR) domains.
    Contains 2 WW domains.
  • Cellular localization
    Cell junction > synapse > synaptosome. Cell membrane. Membrane-associated in synaptosomes.
  • Information by UniProt

Images

  • ab160689 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up