Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASKLLRAVILGPPGSGKGTVCQRIAQNFG LQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENR RGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHP PSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 223
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103301 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Adenylate kinase 3 like 1
    • Adenylate kinase 3-like
    • adenylate kinase 4
    • Adenylate kinase isoenzyme 4, mitochondrial
    • AK3
    • AK3L1
    • AK3L2
    • AK4
    • ATP-AMP transphosphorylase
    • GTP:AMP phosphotransferase
    • KAD4_HUMAN
    • MGC166959
    • mitochondrial adenylate kinase 3
    • nucleoside-triphosphate adenylate kinase
    see all
  • Function
    Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. May also be active with GTP.
  • Sequence similarities
    Belongs to the adenylate kinase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human AK3L1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103301.

References for Recombinant Human AK3L1 protein (ab103301)

ab103301 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up