Overview

  • Product nameRecombinant Human AK5 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y6K8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMNTNDAKEYMARREIPQLFESLLNGL MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSR RSFLRNVMPGNSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFD PTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSS NRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQ ALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLM NFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAA AGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKC KIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIR DIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRR IGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASI PVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF
    • Molecular weight66 kDa including tags
    • Amino acids1 to 562
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity 85 % SDS-PAGE.
    ab113593 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Adenylate kinase 5
    • Adenylate kinase 6
    • Adenylate kinase isoenzyme 5
    • AK 5
    • AK5
    • AK6
    • ATP AMP transphosphorylase 5
    • ATP-AMP transphosphorylase 5
    • KAD5
    • KAD5_HUMAN
    • MGC33326
    see all
  • FunctionActive on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, the enzyme phosphorylates AMP, CMP, and to a small extent dCMP.
  • Tissue specificityBrain specific.
  • Sequence similaritiesBelongs to the adenylate kinase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human AK5 protein images

  • 15% SDS-PAGE analysis of ab113593 (3µg)

References for Recombinant Human AK5 protein (ab113593)

ab113593 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"