Overview

  • Product name
    Recombinant Human AK5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMNTNDAKEYMARREIPQLFESLLNGL MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSR RSFLRNVMPGNSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFD PTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSS NRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQ ALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLM NFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAA AGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKC KIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIR DIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRR IGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASI PVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 562
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    85 % SDS-PAGE.
    ab113593 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Adenylate kinase 5
    • Adenylate kinase 6
    • Adenylate kinase isoenzyme 5
    • AK 5
    • AK5
    • AK6
    • ATP AMP transphosphorylase 5
    • ATP-AMP transphosphorylase 5
    • KAD5
    • KAD5_HUMAN
    • MGC33326
    see all
  • Function
    Active on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, the enzyme phosphorylates AMP, CMP, and to a small extent dCMP.
  • Tissue specificity
    Brain specific.
  • Sequence similarities
    Belongs to the adenylate kinase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113593 (3µg)

References

ab113593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up