Overview

  • Product nameRecombinant Human AK6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y3D8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLLPNILLTGTPGVGKTTLGKELASKSGLK YINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHG CDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYE EATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
    • Molecular weight22 kDa
    • Amino acids1 to 172
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104633 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AD-004
    • Adenylate kinase isoenzyme 6
    • Adrenal gland protein AD-004
    • AK/ATPase
    • AK6
    • CGI-137
    • CIP
    • Coilin-interacting nuclear ATPase protein
    • Dual activity adenylate kinase/ATPase
    • hCINAP
    • KAD6_HUMAN
    • TAF9
    see all
  • FunctionBroad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation.
  • Sequence similaritiesBelongs to the adenylate kinase family. AK6 subfamily.
  • Cellular localizationNucleus > nucleoplasm. Nucleus > Cajal body. Displays widespread diffuse nucleoplasmic distribution but not detected in nucleoli. Detected in Cajal bodies but not in all cells.
  • Information by UniProt

Recombinant Human AK6 protein images

  • 15% SDS-PAGE showing ab104633 (3 µg) at approximately 22.2 kDa. (Molecular weight on SDS-PAGE will appear higher).

References for Recombinant Human AK6 protein (ab104633)

ab104633 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"