Overview

  • Product name
    Recombinant Human AK6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLLPNILLTGTPGVGKTTLGKELASKSGLK YINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHG CDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYE EATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
    • Molecular weight
      22 kDa
    • Amino acids
      1 to 172
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104633 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AD-004
    • Adenylate kinase isoenzyme 6
    • Adrenal gland protein AD-004
    • AK/ATPase
    • AK6
    • CGI-137
    • CIP
    • Coilin-interacting nuclear ATPase protein
    • Dual activity adenylate kinase/ATPase
    • hCINAP
    • KAD6_HUMAN
    • TAF9
    see all
  • Function
    Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation.
  • Sequence similarities
    Belongs to the adenylate kinase family. AK6 subfamily.
  • Cellular localization
    Nucleus > nucleoplasm. Nucleus > Cajal body. Displays widespread diffuse nucleoplasmic distribution but not detected in nucleoli. Detected in Cajal bodies but not in all cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104633 (3 µg) at approximately 22.2 kDa. (Molecular weight on SDS-PAGE will appear higher).

References

ab104633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up