Overview

  • Product name
    Recombinant Human AKAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTAL LAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
    • Amino acids
      806 to 903
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A kinase anchor protein
    • A-kinase anchor protein 1
    • A-kinase anchor protein 149 kDa
    • AKAP
    • AKAP 149
    • Akap1
    • AKAP1_HUMAN
    • D-AKAP-1
    • DAKAP1
    • Dual specificity A-kinase-anchoring protein 1
    • mitochondrial
    • PRKA1
    • Protein kinase A-anchoring protein 1
    • Protein kinase A1
    • S-AKAP84
    • SAKAP84
    • Spermatid A-kinase anchor protein 84
    see all
  • Function
    Binds to type I and II regulatory subunits of protein kinase A and anchors them to the cytoplasmic face of the mitochondrial outer membrane.
  • Tissue specificity
    AKAP149 is highly expressed in prostate and small intestine whereas S-AKAP84 is expressed in kidney, pancreas, liver, lung and brain. AKAP149 is also expressed in colon carcinoma.
  • Sequence similarities
    Contains 1 KH domain.
    Contains 1 Tudor domain.
  • Domain
    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab159952 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up