Recombinant Human AKAP11 protein (ab161353)

Overview

  • Product name
    Recombinant Human AKAP11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSAN KEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLEN A
    • Amino acids
      1801 to 1901
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A-kinase anchor protein 11
    • A-kinase anchor protein 220 kDa
    • AKA11_HUMAN
    • AKAP 220
    • AKAP-11
    • AKAP11
    • hAKAP220
    • PRKA11
    • Protein kinase A-anchoring protein 11
    see all
  • Function
    Binds to type II regulatory subunits of protein kinase A and anchors/targets them.
  • Tissue specificity
    Expressed in heart, brain, lung, liver, kidney, testis and ovary. Weakly expressed in skeletal muscle, pancreas and spleen.
  • Sequence similarities
    Belongs to the AKAP110 family.
  • Domain
    RII-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cytoplasmic in premeiotic pachytene spermatocytes and in the centrosome of developing postmeiotic germ cells, while a midpiece/centrosome localization was found in elongating spermatocytes and mature sperm.
  • Information by UniProt

Images

  • ab161353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up