Recombinant Human AKAP14 protein (ab165706)

Overview

  • Product name
    Recombinant Human AKAP14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINY AVKIVEEERNPLKNIKWMTHGEFTVEKGLKQIDEYFSKCVSKKCWAHGVE FVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMKVSKTKPPDAP IVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPFLFNRV
    • Amino acids
      1 to 197
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A kinase (PRKA) anchor protein 14
    • A kinase anchor protein 14
    • A kinase anchor protein 28 kDa
    • A-kinase anchoring protein 28
    • AKAP14
    • AKAP28
    • PRKA14
    • Protein kinase A anchoring protein 14
    see all
  • Relevance
    Binds to type II regulatory subunits of protein kinase A and anchors/targets them
  • Cellular localization
    Cytoplasmic

Images

  • ab165706 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up