Overview

  • Product name
    Recombinant Human AKAP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTL NVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A kinase (PRKA) anchor protein 4
    • A kinase anchor protein 4
    • A kinase anchor protein 82 kDa
    • A-kinase anchor protein 4
    • A-kinase anchor protein 82 kDa
    • AKAP 4
    • AKAP 82
    • AKAP-4
    • AKAP4
    • AKAP4_HUMAN
    • AKAP82
    • FSC 1
    • FSC1
    • hAKAP 82
    • hAKAP82
    • HI
    • Major sperm fibrous sheath protein
    • p82
    • PRKA 4
    • PRKA4
    • Protein kinase A anchoring protein 4
    • Protein kinase A-anchoring protein 4
    • Testis specific gene HI
    see all
  • Function
    Major structural component of sperm fibrous sheath. Plays a role in sperm motility.
  • Tissue specificity
    Testis specific; only expressed in round spermatids.
  • Sequence similarities
    Belongs to the AKAP110 family.
  • Developmental stage
    Post-meiotic phase of spermatogenesis.
  • Domain
    RI-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization
    Cell projection > cilium > flagellum. Localizes to the principle piece of the sperm flagellum.
  • Information by UniProt

Images

  • ab152924 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up