Recombinant Human Akirin2 protein (ab162968)

Overview

  • Product name
    Recombinant Human Akirin2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAAS FSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLET SFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGM ICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPAS YVS
    • Amino acids
      1 to 203
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AKIR2_HUMAN
    • AKIRIN 2
    • Akirin-2
    • Akirin2
    • C6orf166
    • dJ486L4.2
    • FBI1
    • FLJ10342
    • Fourteen three three beta interactant 1
    • OTTHUMP00000016836
    see all
  • Function
    Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1.
  • Tissue specificity
    Widely expressed with the highest expression in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the akirin family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162968 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up