Overview

  • Product name
    Recombinant Human AKNA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESV RSTTRQMRSSLSADLRQAHSLRGSCLF
    • Amino acids
      1363 to 1439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI597013
    • AKNA transcript F2
    • AT hook containing transcription factor
    • AT hook transcription factor
    • AT hook transcription factor AKNA
    • FLJ31001
    • FLJ33184
    • KIAA1968
    • MGC116630
    • mKIAA1968
    • OTTHUMP00000021973
    • OTTHUMP00000021974
    • OTTMUSP00000015051
    • RP11 82I1.4
    • RP23-340H1.6
    see all
  • Relevance
    AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters.
  • Cellular localization
    Nuclear

Images

  • ab164278 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up