Recombinant Human AKR1A1 protein (ab117169)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIY GNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLA DLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEAL VAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHC QARGLEVTAYSPLGSSDRAWRDPDEPVLLEPVVLALAEKYGRSPAQILLR WQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVP MLTVDGKRVPRDAGHPLYPFNDPY
    • Molecular weight
      37 kDa
    • Amino acids
      1 to 325

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab117169 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.15% Tris, 0.29% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • AK1A1_HUMAN
    • Akr1a1
    • Alcohol dehydrogenase
    • Alcohol dehydrogenase [NADP+]
    • Aldehyde reductase
    • Aldo keto reductase family 1 member A1 (aldehyde reductase)
    • Aldo-keto reductase family 1 member A1
    • ALDR1
    • ALR
    • ARM
    • DD3
    • MGC12529
    • MGC1380
    see all
  • Function
    Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. In vitro substrates include succinic semialdehyde, 4-nitrobenzaldehyde, 1,2-naphthoquinone, methylglyoxal, and D-glucuronic acid. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs, including the anthracyclines doxorubicin (DOX) and daunorubicin (DAUN).
  • Tissue specificity
    Widely expressed. Highly expressed in kidney, salivary gland and liver. Detected in trachea, stomach, brain, lung, prostate, placenta, mammary gland, small intestine and lung.
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Information by UniProt

References for Recombinant Human AKR1A1 protein (ab117169)

ab117169 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up