Recombinant Human AKR1B10 protein (ab117185)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQ NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL KLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVD EGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC HSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLI RFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN VLQSSHLEDYPFDAEY
    • Molecular weight
      36 kDa
    • Amino acids
      1 to 316

Specifications

Our Abpromise guarantee covers the use of ab117185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117185 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable at 4°C for 1 week, ab117185 should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • AK1BA_HUMAN
    • AKR1B10
    • AKR1B11
    • AKR1B12
    • Aldo keto reductase family 1 member B10
    • aldo keto reductase family 1 member B11
    • Aldo-keto reductase family 1 member B10
    • Aldo-keto reductase family 1 member B10 (aldose reductase)
    • Aldo-keto reductase family 1 member B11 (aldose reductase-like)
    • Aldose reductase like
    • aldose reductase like 1
    • aldose reductase like peptide
    • Aldose reductase related protein
    • Aldose reductase-like
    • Aldose reductase-related protein
    • ALDRLn
    • ARL 1
    • ARL-1
    • ARL1
    • ARL1 Human small intestine reductase
    • ARP
    • hARP
    • HIS
    • HSI
    • SI reductase
    • Small intestine reductase
    see all
  • Function
    Acts as all-trans-retinaldehyde reductase. Can efficiently reduce aliphatic and aromatic aldehydes, and is less active on hexoses (in vitro). May be responsible for detoxification of reactive aldehydes in the digested food before the nutrients are passed on to other organs.
  • Tissue specificity
    Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Cellular localization
    Lysosome. Secreted. Secreted through a lysosome-mediated non-classical pathway.
  • Information by UniProt

References for Recombinant Human AKR1B10 protein (ab117185)

ab117185 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up